FADS1 anticorps (C-Term)

N° du produit ABIN630410

Détail du produit anti-FADS1 anticorps

Antigène: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FADS1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: FADS1 antibody was raised against the C terminal of FADS1

Purification: Purified

Immunogène: FADS1 antibody was raised using the C terminal of FADS1 corresponding to a region with amino acids FNDWFSGHLNFQIEHHLFPTMPRHNYHKVAPLVQSLCAKHGIEYQSKPLL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FADS1 Blocking Peptide, catalog no. 33R-3002, is also available for use as a blocking control in assays to test for specificity of this FADS1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FADS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FADS1

Antigène: FADS1 (Fatty Acid Desaturase 1 (FADS1))

Autre désignation: FADS1 (FADS1 Produits)

Synonymes: anticorps D5D, anticorps FADS6, anticorps FADSD5, anticorps LLCDL1, anticorps TU12, anticorps D5FAD, anticorps 0710001O03Rik, anticorps A930006B21Rik, anticorps AI317215, anticorps DSD, anticorps fatty acid desaturase 1, anticorps FADS1, anticorps LOC483793, anticorps Fads1

Sujet: FADS1 is a member of the fatty acid desaturase (FADS) family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs.

Poids moléculaire: 49 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha