FGG anticorps (Middle Region)

N° du produit ABIN630420

Cet anticorps anti-FGG est un anticorps Lapin Polyclonal détectant FGG dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour FGG anticorps (Middle Region) (ABIN630420)

Antigène: FGG (Fibrinogen gamma Chain (FGG))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FGG anticorps

Épitope: Middle Region

Specificité: FGG antibody was raised against the middle region of FGG

Purification: Purified

Immunogène: FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGG Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this FGG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGG

Antigène: FGG (Fibrinogen gamma Chain (FGG))

Autre désignation: FGG

Sujet: FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.

Poids moléculaire: 46 kDa (MW of target protein)