FGG anticorps (Middle Region)

N° du produit ABIN630420

Détail du produit anti-FGG anticorps

Antigène: FGG (Fibrinogen gamma Chain (FGG))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGG est non-conjugé

Application: Western Blotting (WB)

Specificité: FGG antibody was raised against the middle region of FGG

Purification: Purified

Immunogène: FGG antibody was raised using the middle region of FGG corresponding to a region with amino acids RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGG Blocking Peptide, catalog no. 33R-8054, is also available for use as a blocking control in assays to test for specificity of this FGG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGG

Antigène: FGG (Fibrinogen gamma Chain (FGG))

Autre désignation: FGG (FGG Produits)

Synonymes: anticorps FXII, anticorps HAF, anticorps 3010002H13Rik, anticorps AI256424, anticorps fibrinogen, anticorps FGG, anticorps LOC100220680, anticorps fb60h05, anticorps fb62e01, anticorps wu:fb60h05, anticorps wu:fb62e01, anticorps zgc:56023, anticorps fibrinogen gamma chain, anticorps coagulation factor XII (Hageman factor), anticorps fibrinogen gamma chain L homeolog, anticorps FGG, anticorps F12, anticorps fgg, anticorps Fgg, anticorps fgg.L, anticorps CpipJ_CPIJ006387, anticorps CpipJ_CPIJ010087

Sujet: FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.

Poids moléculaire: 46 kDa (MW of target protein)