SLC29A2 anticorps

N° du produit ABIN630424

Détail du produit anti-SLC29A2 anticorps

Antigène: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC29A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC29A2 Blocking Peptide, catalog no. 33R-1475, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC29A2

Antigène: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Autre désignation: SLC29A2 (SLC29A2 Produits)

Synonymes: anticorps DER12, anticorps ENT2, anticorps HNP36, anticorps Der12, anticorps Ent2, anticorps Hnp36, anticorps ent2, anticorps der12, anticorps hnp36, anticorps MGC82995, anticorps DKFZp468L038, anticorps zgc:110527, anticorps solute carrier family 29 member 2, anticorps solute carrier family 29 (nucleoside transporters), member 2, anticorps solute carrier family 29 (equilibrative nucleoside transporter), member 2 L homeolog, anticorps solute carrier family 29 (equilibrative nucleoside transporter), member 2, anticorps SLC29A2, anticorps Slc29a2, anticorps slc29a2.L, anticorps slc29a2

Sujet: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Poids moléculaire: 50 kDa (MW of target protein)