SLC46A3 anticorps (N-Term)

N° du produit ABIN630428

L’anticorps Lapin Polyclonal anti-SLC46A3 a été validé pour IHC et WB. Il convient pour détecter SLC46A3 dans des échantillons de Humain.

Aperçu rapide pour SLC46A3 anticorps (N-Term) (ABIN630428)

Antigène: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC46A3 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit anti-SLC46A3 anticorps

Épitope: N-Term

Specificité: SLC46 A3 antibody was raised against the N terminal of SLC46 3

Purification: Purified

Immunogène: SLC46 A3 antibody was raised using the N terminal of SLC46 3 corresponding to a region with amino acids MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC46A3 Blocking Peptide, (ABIN5616260), is also available for use as a blocking control in assays to test for specificity of this SLC46A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC46A3

Antigène: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Autre désignation: SLC46A3

Sujet: The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 51 kDa (MW of target protein)