SLC46A3 anticorps (N-Term)

N° du produit ABIN630428

Détail du produit anti-SLC46A3 anticorps

Antigène: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC46A3 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: SLC46 A3 antibody was raised against the N terminal of SLC46 3

Purification: Purified

Immunogène: SLC46 A3 antibody was raised using the N terminal of SLC46 3 corresponding to a region with amino acids MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISEC

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC46A3 Blocking Peptide, catalog no. 33R-6144, is also available for use as a blocking control in assays to test for specificity of this SLC46A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC46A3

Antigène: SLC46A3 (Solute Carrier Family 46, Member 3 (SLC46A3))

Autre désignation: SLC46A3 (SLC46A3 Produits)

Synonymes: anticorps SLC46A3, anticorps DKFZp469J2134, anticorps FKSG16, anticorps 1200006F02Rik, anticorps RGD1307594, anticorps solute carrier family 46 member 3, anticorps solute carrier family 46, member 3, anticorps SLC46A3, anticorps slc46a3, anticorps Slc46a3

Sujet: The function of SLC46A3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 51 kDa (MW of target protein)