MGAT2 anticorps

N° du produit ABIN630430

Cet anticorps Lapin Polyclonal détecte spécifiquement MGAT2 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour MGAT2 anticorps (ABIN630430)

Antigène: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MGAT2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MGAT2 anticorps

Purification: Purified

Immunogène: MGAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGAT2 Blocking Peptide, (ABIN5614742), is also available for use as a blocking control in assays to test for specificity of this MGAT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGAT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MGAT2

Antigène: MGAT2 (Mannosyl (Alpha-1,6-)-Glycoprotein beta-1,2-N-Acetylglucosaminyltransferase (MGAT2))

Autre désignation: MGAT2

Sujet: MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.

Poids moléculaire: 51 kDa (MW of target protein)