Tyrosinase-Related Protein 1 anticorps (N-Term)
-
- Antigène Voir toutes Tyrosinase-Related Protein 1 (TYRP1) Anticorps
- Tyrosinase-Related Protein 1 (TYRP1)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Tyrosinase-Related Protein 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TYRP1 antibody was raised against the N terminal of TYRP1
- Purification
- Purified
- Immunogène
- TYRP1 antibody was raised using the N terminal of TYRP1 corresponding to a region with amino acids AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF
- Top Product
- Discover our top product TYRP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TYRP1 Blocking Peptide, catalog no. 33R-1310, is also available for use as a blocking control in assays to test for specificity of this TYRP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYRP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Tyrosinase-Related Protein 1 (TYRP1)
- Autre désignation
- TYRP1 (TYRP1 Produits)
- Synonymes
- anticorps CAS2, anticorps CATB, anticorps GP75, anticorps OCA3, anticorps TRP, anticorps TRP1, anticorps TYRP, anticorps b-PROTEIN, anticorps LOC397853, anticorps Trypsin, anticorps hm:zeh0659, anticorps tyrp1, anticorps zgc:100893, anticorps B, anticorps TYRP1, anticorps tyrp-1, anticorps TRP-1, anticorps Tyrp, anticorps b, anticorps brown, anticorps isa, anticorps tyrosinase related protein 1, anticorps protease, serine 1 L homeolog, anticorps tyrosinase-related protein 1b, anticorps tyrosinase-related protein 1, anticorps tyrosinase-related protein 1 L homeolog, anticorps tyrosinase-related protein 1a, anticorps TYRP1, anticorps prss1.L, anticorps tyrp1b, anticorps Tyrp1, anticorps tyrp1.L, anticorps tyrp1, anticorps LOC100136490, anticorps tyrp-1, anticorps tyrp1a
- Sujet
- TYRP1 catalyses the oxidation of 5,6-dihydroxyindole-2-carboxylic acid (DHICA) into indole-5,6-quinone-2-carboxylic acid. It may regulate or influence the type of melanin synthesized.
- Poids moléculaire
- 59 kDa (MW of target protein)
-