PPIB anticorps

N° du produit ABIN630436

Cet anticorps Lapin Polyclonal détecte spécifiquement PPIB dans WB et IHC. Il présente une réactivité envers Humain, Souris et Chien.

Aperçu rapide pour PPIB anticorps (ABIN630436)

Antigène: PPIB (Cyclophilin B (PPIB))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPIB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PPIB anticorps

Purification: Purified

Immunogène: PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPIB Blocking Peptide, (ABIN938323), is also available for use as a blocking control in assays to test for specificity of this PPIB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPIB

Antigène: PPIB (Cyclophilin B (PPIB))

Autre désignation: PPIB

Sujet: PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Poids moléculaire: 24 kDa (MW of target protein)