IL-10RA anticorps (N-Term)

N° du produit ABIN630438

Cet anticorps anti-IL-10RA est un anticorps Lapin Polyclonal détectant IL-10RA dans WB. Adapté pour Humain.

Aperçu rapide pour IL-10RA anticorps (N-Term) (ABIN630438)

Antigène: IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-10RA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-10RA anticorps

Épitope: N-Term

Specificité: IL10 R Alpha antibody was raised against the N terminal of IL10 A

Purification: Purified

Immunogène: IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL10R Alpha Blocking Peptide, (ABIN938981), is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-10RA

Antigène: IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))

Autre désignation: IL10R alpha

Sujet: IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.

Poids moléculaire: 61 kDa (MW of target protein)

Pathways: Growth Factor Binding