IL-10RA anticorps (N-Term)
-
- Antigène Voir toutes IL-10RA (IL10RA) Anticorps
- IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-10RA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IL10 R Alpha antibody was raised against the N terminal of IL10 A
- Purification
- Purified
- Immunogène
- IL10 R Alpha antibody was raised using the N terminal of IL10 A corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
- Top Product
- Discover our top product IL10RA Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL-10RA (IL10RA) (Interleukin 10 Receptor, alpha (IL10RA))
- Autre désignation
- IL10R alpha (IL10RA Produits)
- Synonymes
- anticorps IL10R1, anticorps IL10RA, anticorps CD210, anticorps CD210a, anticorps CDW210A, anticorps HIL-10R, anticorps IL-10R1, anticorps IL10R, anticorps AW553859, anticorps CDw210, anticorps CDw210a, anticorps Il10r, anticorps mIL-10R, anticorps interleukin 10 receptor subunit alpha, anticorps interleukin 10 receptor, alpha, anticorps IL10RA, anticorps Il10ra
- Sujet
- IL10RA is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Growth Factor Binding
-