PIGV anticorps (N-Term)

N° du produit ABIN630452

L’anticorps anti-PIGV Polyclonal Lapin est utilisé pour la détection de PIGV dans des échantillons de Humain, Chien, Souris et Rat. Il a été validé pour WB et IHC.

Aperçu rapide pour PIGV anticorps (N-Term) (ABIN630452)

Antigène: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Reactivité: Humain, Chien, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGV est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PIGV anticorps

Épitope: N-Term

Specificité: PIGV antibody was raised against the N terminal of PIGV

Purification: Purified

Immunogène: PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGV Blocking Peptide, (ABIN938497), is also available for use as a blocking control in assays to test for specificity of this PIGV antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGV antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIGV

Antigène: PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))

Autre désignation: PIGV

Sujet: Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Inositol Metabolic Process