TYR anticorps

N° du produit ABIN630459

Cet anticorps anti-TYR est un anticorps Polyclonal produit chez le Lapin, détectant TYR dans WB. Convient pour Humain, Souris, Rat et Chien.

Aperçu rapide pour TYR anticorps (ABIN630459)

Antigène: TYR (Tyrosinase (TYR))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TYR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TYR anticorps

Purification: Purified

Immunogène: TYR antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TYR Blocking Peptide, (ABIN937131), is also available for use as a blocking control in assays to test for specificity of this TYR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TYR

Antigène: TYR (Tyrosinase (TYR))

Autre désignation: TYR

Sujet: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.

Poids moléculaire: 58 kDa (MW of target protein)