SLC43A3 anticorps (N-Term)

N° du produit ABIN630461

L’anticorps Lapin Polyclonal anti-SLC43A3 a été validé pour IHC et WB. Il convient pour détecter SLC43A3 dans des échantillons de Humain.

Aperçu rapide pour SLC43A3 anticorps (N-Term) (ABIN630461)

Antigène: SLC43A3 (Solute Carrier Family 43, Member 3 (SLC43A3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC43A3 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Détail du produit anti-SLC43A3 anticorps

Épitope: N-Term

Specificité: SLC43 A3 antibody was raised against the N terminal of SLC43 3

Purification: Purified

Immunogène: SLC43 A3 antibody was raised using the N terminal of SLC43 3 corresponding to a region with amino acids MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC43A3 Blocking Peptide, (ABIN5616256), is also available for use as a blocking control in assays to test for specificity of this SLC43A3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC43A3

Antigène: SLC43A3 (Solute Carrier Family 43, Member 3 (SLC43A3))

Autre désignation: SLC43A3

Sujet: SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.

Poids moléculaire: 54 kDa (MW of target protein)