TMEM109 anticorps (Middle Region)

N° du produit ABIN630474

Cet anticorps anti-TMEM109 Polyclonal Lapin (ABIN630474) détecte spécifiquement TMEM109 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour TMEM109 anticorps (Middle Region) (ABIN630474)

Antigène: TMEM109 (Transmembrane Protein 109 (TMEM109))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM109 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TMEM109 anticorps

Épitope: Middle Region

Specificité: TMEM109 antibody was raised against the middle region of TMEM109

Purification: Purified

Immunogène: TMEM109 antibody was raised using the middle region of TMEM109 corresponding to a region with amino acids GIAAQLLNALGLAGDYLAQGLKLSPGQVQTFLLWGAGALVVYWLLSLLLG

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM109 Blocking Peptide, (ABIN938708), is also available for use as a blocking control in assays to test for specificity of this TMEM109 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM109 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM109

Antigène: TMEM109 (Transmembrane Protein 109 (TMEM109))

Autre désignation: TMEM109

Sujet: The function of TMEM109 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 26 kDa (MW of target protein)