MBOAT7 anticorps (C-Term)

N° du produit ABIN630475

Cet anticorps Lapin Polyclonal détecte spécifiquement MBOAT7 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MBOAT7 anticorps (C-Term) (ABIN630475)

Antigène: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBOAT7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MBOAT7 anticorps

Épitope: C-Term

Specificité: LENG4 antibody was raised against the C terminal Of Leng4

Purification: Purified

Immunogène: LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LENG4 Blocking Peptide, (ABIN5614443), is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBOAT7

Antigène: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Autre désignation: LENG4

Sujet: The function of LENG4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process