ST6GALNAC5 anticorps (Middle Region)

N° du produit ABIN630476

L’anticorps anti-ST6GALNAC5 Polyclonal Lapin est utilisé pour la détection de ST6GALNAC5 dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour ST6GALNAC5 anticorps (Middle Region) (ABIN630476)

Antigène: ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST6GALNAC5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ST6GALNAC5 anticorps

Épitope: Middle Region

Specificité: ST6 GALNAC5 antibody was raised against the middle region of ST6 ALNAC5

Purification: Purified

Immunogène: ST6 GALNAC5 antibody was raised using the middle region of ST6 ALNAC5 corresponding to a region with amino acids AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST6GALNAC5 Blocking Peptide, (ABIN936553), is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST6GALNAC5

Antigène: ST6GALNAC5 (ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 5 (ST6GALNAC5))

Autre désignation: ST6GALNAC5

Sujet: ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.

Poids moléculaire: 38 kDa (MW of target protein)