CHST7 anticorps

N° du produit ABIN630479

L’anticorps anti-CHST7 Polyclonal Lapin est utilisé pour la détection de CHST7 dans des échantillons de Souris, Humain et Chien. Il a été validé pour WB.

Aperçu rapide pour CHST7 anticorps (ABIN630479)

Antigène: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Reactivité: Souris, Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHST7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHST7 anticorps

Purification: Purified

Immunogène: CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHST7 Blocking Peptide, (ABIN937431), is also available for use as a blocking control in assays to test for specificity of this CHST7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHST7

Antigène: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Autre désignation: CHST7

Sujet: CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process