TMEM178 anticorps (Middle Region)

N° du produit ABIN630480

Détail du produit anti-TMEM178 anticorps

Antigène: TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM178 est non-conjugé

Application: Western Blotting (WB)

Specificité: MGC33926 antibody was raised against the middle region of Mgc33926

Purification: Purified

Immunogène: MGC33926 antibody was raised using the middle region of Mgc33926 corresponding to a region with amino acids RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MGC33926 Blocking Peptide, catalog no. 33R-8049, is also available for use as a blocking control in assays to test for specificity of this MGC33926 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC33926 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM178

Antigène: TMEM178 (TMEM178A) (Transmembrane Protein 178A (TMEM178A))

Abstract: TMEM178A Produits

Synonymes: anticorps TMEM178, anticorps 2810417M05Rik, anticorps Tmem178a, anticorps Tmem178, anticorps tmem178, anticorps tmem178.1, anticorps tmem178a, anticorps zgc:153181, anticorps transmembrane protein 178A, anticorps transmembrane protein 178, anticorps transmembrane protein 178A S homeolog, anticorps TMEM178A, anticorps Tmem178, anticorps Tmem178a, anticorps tmem178a.S, anticorps tmem178

Sujet: The function of MGC33926 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 33 kDa (MW of target protein)