STS anticorps

N° du produit ABIN630487

Cet anticorps Lapin Polyclonal détecte spécifiquement STS dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour STS anticorps (ABIN630487)

Antigène: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-STS anticorps

Purification: Purified

Immunogène: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STS Blocking Peptide, (ABIN940521), is also available for use as a blocking control in assays to test for specificity of this STS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STS

Antigène: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Autre désignation: STS

Sujet: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis