STS anticorps

N° du produit ABIN630487

Détail du produit anti-STS anticorps

Antigène: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STS est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: STS antibody was raised using a synthetic peptide corresponding to a region with amino acids LLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSW

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STS Blocking Peptide, catalog no. 33R-5135, is also available for use as a blocking control in assays to test for specificity of this STS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STS

Antigène: STS (Steroid Sulfatase (Microsomal), Isozyme S (STS))

Autre désignation: STS (STS Produits)

Synonymes: anticorps ARSC, anticorps ARSC1, anticorps ASC, anticorps ES, anticorps SSDD, anticorps XLI, anticorps abcg2, anticorps ArsC, anticorps Sts, anticorps si:ch211-271l9.1, anticorps steroid sulfatase, anticorps breast cancer resistance protein, anticorps Steryl-sulfatase, anticorps steryl-sulfatase, anticorps steroid sulfatase (microsomal), isozyme S, anticorps STS, anticorps abcg2, anticorps Sts, anticorps Plav_0360, anticorps Psta_3963, anticorps Runsl_5106, anticorps LOC100712701, anticorps sts

Sujet: STS catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in its gene are known to cause X-linked ichthyosisThe protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI).

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis