HNF4 gamma anticorps (C-Term)

N° du produit ABIN630491

L’anticorps Lapin Polyclonal anti-HNF4 gamma a été validé pour WB. Il convient pour détecter HNF4 gamma dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour HNF4 gamma anticorps (C-Term) (ABIN630491)

Antigène: HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNF4 gamma est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HNF4 gamma anticorps

Épitope: C-Term

Specificité: HNF4 G antibody was raised against the C terminal of HNF4

Purification: Affinity purified

Immunogène: HNF4 G antibody was raised using the C terminal of HNF4 corresponding to a region with amino acids QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNF4G Blocking Peptide, (ABIN5614037), is also available for use as a blocking control in assays to test for specificity of this HNF4G antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNF4 gamma

Antigène: HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))

Autre désignation: HNF4G

Sujet: HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway