Retinoid X Receptor alpha anticorps (C-Term)

N° du produit ABIN630496

Cet anticorps Lapin Polyclonal détecte spécifiquement Retinoid X Receptor alpha dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour Retinoid X Receptor alpha anticorps (C-Term) (ABIN630496)

Antigène: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Retinoid X Receptor alpha est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Retinoid X Receptor alpha anticorps

Épitope: C-Term

Specificité: RXRA antibody was raised against the C terminal of RXRA

Purification: Affinity purified

Immunogène: RXRA antibody was raised using the C terminal of RXRA corresponding to a region with amino acids MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RXRA Blocking Peptide, (ABIN5615982), is also available for use as a blocking control in assays to test for specificity of this RXRA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Retinoid X Receptor alpha

Antigène: Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))

Autre désignation: RXRA

Sujet: Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C