ESRRA anticorps (N-Term)

N° du produit ABIN630497

L’anticorps Lapin Polyclonal anti-ESRRA a été validé pour WB. Il convient pour détecter ESRRA dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ESRRA anticorps (N-Term) (ABIN630497)

Antigène: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESRRA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ESRRA anticorps

Épitope: N-Term

Specificité: ESRRA antibody was raised against the N terminal of ESRRA

Purification: Affinity purified

Immunogène: ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ESRRA Blocking Peptide, (ABIN939722), is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESRRA

Antigène: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Autre désignation: ESRRA

Sujet: ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha