ESRRA anticorps (N-Term)

N° du produit ABIN630497

Détail du produit anti-ESRRA anticorps

Antigène: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESRRA est non-conjugé

Application: Western Blotting (WB)

Specificité: ESRRA antibody was raised against the N terminal of ESRRA

Purification: Affinity purified

Immunogène: ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ESRRA Blocking Peptide, catalog no. 33R-4336, is also available for use as a blocking control in assays to test for specificity of this ESRRA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESRRA

Antigène: ESRRA (Estrogen-Related Receptor alpha (ESRRA))

Autre désignation: ESRRA (ESRRA Produits)

Synonymes: anticorps err1, anticorps erra, anticorps esrral, anticorps erralpha, anticorps nr3b1, anticorps MGC80854, anticorps ESRRA, anticorps esrl1, anticorps LOC100125507, anticorps ERRalpha, anticorps Err1, anticorps Estrra, anticorps Nr3b1, anticorps Errra, anticorps ERR1, anticorps ERRa, anticorps ESRL1, anticorps NR3B1, anticorps ESTRRA, anticorps estrogen-related receptor alpha, anticorps estrogen related receptor alpha L homeolog, anticorps estrogen related receptor alpha, anticorps catsper channel auxiliary subunit zeta, anticorps estrogen related receptor, alpha, anticorps esrra, anticorps esrra.L, anticorps ESRRA, anticorps LOC100125507, anticorps CATSPERZ, anticorps Esrra

Sujet: ESRRA is a nuclear receptor that is closely related to the estrogen receptor. This protein acts as a site-specific transcription regulator and has been also shown to interact with estrogen and the transcripton factor TFIIB by direct protein-protein contact. The binding and regulatory activities of this protein have been demonstrated in the regulation of a variety of genes including lactoferrin, osteopontin, medium-chain acyl coenzyme A dehydrogenase (MCAD) and thyroid hormone receptor genes.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha