Retinoid X Receptor gamma anticorps (N-Term)

N° du produit ABIN630498

Détail du produit anti-Retinoid X Receptor gamma anticorps

Antigène: Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Retinoid X Receptor gamma est non-conjugé

Application: Western Blotting (WB)

Specificité: RXRG antibody was raised against the N terminal of RXRG

Purification: Affinity purified

Immunogène: RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Retinoid X Receptor gamma

Antigène: Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))

Autre désignation: RXRG (RXRG Produits)

Synonymes: anticorps NR2B3, anticorps RXRC, anticorps zgc:92183, anticorps RXRgamma, anticorps RXRG, anticorps RXR-gamma, anticorps nr2b3, anticorps xrxrg, anticorps rxrc, anticorps Nr2b3, anticorps NR2B1, anticorps RXR, anticorps rxra, anticorps rxrg, anticorps retinoid X receptor gamma, anticorps retinoid X receptor, gamma b, anticorps retinoid X receptor gamma L homeolog, anticorps retinoid x receptor, gamma a, anticorps RXRG, anticorps rxrgb, anticorps rxrg.L, anticorps rxrg, anticorps Rxrg, anticorps RXRGAMMA, anticorps rxrga

Sujet: RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway