Vitamin D Receptor anticorps (N-Term)

N° du produit ABIN630503

Détail du produit anti-Vitamin D Receptor anticorps

Antigène: Vitamin D Receptor (VDR)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Vitamin D Receptor est non-conjugé

Application: Western Blotting (WB)

Specificité: VDR antibody was raised against the N terminal of VDR

Purification: Affinity purified

Immunogène: VDR antibody was raised using the N terminal of VDR corresponding to a region with amino acids ILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VDR Blocking Peptide, catalog no. 33R-4052, is also available for use as a blocking control in assays to test for specificity of this VDR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Vitamin D Receptor

Antigène: Vitamin D Receptor (VDR)

Autre désignation: VDR (VDR Produits)

Synonymes: anticorps vdrbeta, anticorps vdr0, anticorps LOC100136219, anticorps NR1I1-B, anticorps gb:dq017633, anticorps vdr-b, anticorps Ci-VDR-b, anticorps VDR, anticorps LOC100221284, anticorps vdr-A, anticorps xVDR, anticorps Nr1i1, anticorps vdr, anticorps NR1I1, anticorps PPP1R163, anticorps vitamin D (1,25- dihydroxyvitamin D3) receptor, anticorps vitamin D receptor, anticorps vitamin D3 receptor A, anticorps vitamin D receptor b, anticorps nuclear receptor VDR-b, anticorps vitamin D (1,25- dihydroxyvitamin D3) receptor L homeolog, anticorps vitamin D (1,25-dihydroxyvitamin D3) receptor, anticorps vitamin D receptor a, anticorps vdr, anticorps vdr0, anticorps VDR, anticorps LOC100136219, anticorps vdrb, anticorps vdr-b, anticorps vdr.L, anticorps Vdr, anticorps vdra

Classe de substances: Chemical

Sujet: VDR is the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarit

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway