ESRRG anticorps (N-Term)

N° du produit ABIN630513

Détail du produit anti-ESRRG anticorps

Antigène: ESRRG (Estrogen-Related Receptor gamma (ESRRG))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ESRRG est non-conjugé

Application: Western Blotting (WB)

Specificité: ESRRG antibody was raised against the N terminal of ESRRG

Purification: Affinity purified

Immunogène: ESRRG antibody was raised using the N terminal of ESRRG corresponding to a region with amino acids DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ESRRG Blocking Peptide, catalog no. 33R-2143, is also available for use as a blocking control in assays to test for specificity of this ESRRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ESRRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ESRRG

Antigène: ESRRG (Estrogen-Related Receptor gamma (ESRRG))

Autre désignation: ESRRG (ESRRG Produits)

Synonymes: anticorps ERR3, anticorps ERRgamma, anticorps NR3B3, anticorps ESRRG, anticorps USH2A, anticorps DKFZp459J0417, anticorps err3, anticorps nr3b3, anticorps LOC100219115, anticorps errg, anticorps errgamma, anticorps esrrg, anticorps errb/g, anticorps esrrgl, anticorps errbeta/gamma, anticorps Errg, anticorps mKIAA0832, anticorps estrogen related receptor gamma, anticorps estrogen-related receptor gamma, anticorps estrogen-related receptor gamma a, anticorps estrogen-related receptor gamma b, anticorps ESRRG, anticorps esrrg, anticorps Esrrg, anticorps esrrga, anticorps esrrgb

Sujet: ERRs, which are coexpressed with ERs in prostatic cells, could regulate cell growth and modulate ER-mediated pathways via interference on ERalpha transcription in prostatic cells. Not only PNRC2 but also the corepressor TLE1 functioned as ERRgamma coactivator in a reporter gene analysis. Transcriptional activation by ERR3 can be ligand-independent.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway