HBS1L anticorps

N° du produit ABIN630516

Cet anticorps anti-HBS1L est un anticorps Lapin Polyclonal détectant HBS1L dans WB. Adapté pour Hepatitis B Virus (HBV).

Aperçu rapide pour HBS1L anticorps (ABIN630516)

Antigène: HBS1L (HBS1-Like (HBS1L))

Reactivité: Hepatitis B Virus (HBV)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HBS1L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HBS1L anticorps

Purification: Affinity purified

Immunogène: HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HBS1L Blocking Peptide, (ABIN5613941), is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HBS1L

Antigène: HBS1L (HBS1-Like (HBS1L))

Sujet: HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Poids moléculaire: 22 kDa (MW of target protein)