CRAT anticorps (N-Term)

N° du produit ABIN630518

Détail du produit anti-CRAT anticorps

Antigène: CRAT (Carnitine O-Acetyltransferase (CRAT))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRAT est non-conjugé

Application: Western Blotting (WB)

Specificité: CRAT antibody was raised against the N terminal of CRAT

Purification: Affinity purified

Immunogène: CRAT antibody was raised using the N terminal of CRAT corresponding to a region with amino acids MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRAT Blocking Peptide, catalog no. 33R-6123, is also available for use as a blocking control in assays to test for specificity of this CRAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRAT

Antigène: CRAT (Carnitine O-Acetyltransferase (CRAT))

Autre désignation: CRAT (CRAT Produits)

Synonymes: anticorps CAT1, anticorps AW107812, anticorps CARAT, anticorps CAT, anticorps Carnitine acetylase, anticorps CrAT, anticorps hm:zeh0248, anticorps zgc:92317, anticorps carnitine O-acetyltransferase, anticorps carnitine acetyltransferase, anticorps Carnitine acetyltransferase, anticorps Carnitine acetyltransferase, putative, anticorps carnitine O-acetyltransferase a, anticorps CRAT, anticorps Crat, anticorps CNA05200, anticorps CNL05760, anticorps CC1G_06292, anticorps PAS_chr3_0761, anticorps CGB_A5470W, anticorps CGB_D1240C, anticorps crata

Sujet: Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT geneuggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process