IL13RA2 anticorps (N-Term)

N° du produit ABIN630522

Cet anticorps anti-IL13RA2 est un anticorps Lapin Polyclonal détectant IL13RA2 dans WB. Adapté pour Humain et Chien.

Aperçu rapide pour IL13RA2 anticorps (N-Term) (ABIN630522)

Antigène: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL13RA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL13RA2 anticorps

Épitope: N-Term

Specificité: IL13 RA2 antibody was raised against the N terminal of IL13 A2

Purification: Affinity purified

Immunogène: IL13 RA2 antibody was raised using the N terminal of IL13 A2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL13RA2 Blocking Peptide, (ABIN937359), is also available for use as a blocking control in assays to test for specificity of this IL13RA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL10 A2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL13RA2

Antigène: IL13RA2 (Interleukin 13 Receptor, alpha 2 (IL13RA2))

Autre désignation: IL13RA2

Sujet: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.

Poids moléculaire: 22 kDa (MW of target protein)