Septin 6 anticorps (N-Term)

N° du produit ABIN630523

Cet anticorps Lapin Polyclonal détecte spécifiquement Septin 6 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour Septin 6 anticorps (N-Term) (ABIN630523)

Antigène: Septin 6 (SEPT6)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Septin 6 anticorps

Épitope: N-Term

Specificité: Septin 6 antibody was raised against the N terminal of 40427

Purification: Affinity purified

Immunogène: Septin 6 antibody was raised using the N terminal of 40427 corresponding to a region with amino acids TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 38961 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 6

Antigène: Septin 6 (SEPT6)

Autre désignation: Septin 6

Sujet: SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.

Poids moléculaire: 12 kDa (MW of target protein)