SQLE anticorps (C-Term)

N° du produit ABIN630528

Cet anticorps anti-SQLE est un anticorps Lapin Polyclonal détectant SQLE dans WB et IHC. Adapté pour Humain et Souris.

Aperçu rapide pour SQLE anticorps (C-Term) (ABIN630528)

Antigène: SQLE (Squalene Epoxidase (SQLE))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SQLE est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SQLE anticorps

Épitope: C-Term

Specificité: SQLE antibody was raised against the C terminal of SQLE

Purification: Affinity purified

Immunogène: SQLE antibody was raised using the C terminal of SQLE corresponding to a region with amino acids KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SQLE Blocking Peptide, (ABIN939879), is also available for use as a blocking control in assays to test for specificity of this SQLE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SQLE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SQLE

Antigène: SQLE (Squalene Epoxidase (SQLE))

Autre désignation: SQLE

Sujet: Squalene epoxidase catalyzes the first oxygenation step in sterol biosynthesis and is thought to be one of the rate-limiting enzymes in this pathway.

Poids moléculaire: 39 kDa (MW of target protein)