AGBL5 anticorps (C-Term)

N° du produit ABIN630529

Cet anticorps Lapin Polyclonal détecte spécifiquement AGBL5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour AGBL5 anticorps (C-Term) (ABIN630529)

Antigène: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGBL5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-AGBL5 anticorps

Épitope: C-Term

Specificité: AGBL5 antibody was raised against the C terminal of AGBL5

Purification: Affinity purified

Immunogène: AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGBL5 Blocking Peptide, (ABIN5611971), is also available for use as a blocking control in assays to test for specificity of this AGBL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGBL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGBL5

Antigène: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Autre désignation: AGBL5

Sujet: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Poids moléculaire: 47 kDa (MW of target protein)