AGBL5 anticorps (C-Term)

N° du produit ABIN630529

Détail du produit anti-AGBL5 anticorps

Antigène: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AGBL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: AGBL5 antibody was raised against the C terminal of AGBL5

Purification: Affinity purified

Immunogène: AGBL5 antibody was raised using the C terminal of AGBL5 corresponding to a region with amino acids NLRAWMLKHVRNSRGLSSTLNVGVNKKRGLRTPPKSHNGLPVSCSENTLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AGBL5 Blocking Peptide, catalog no. 33R-6772, is also available for use as a blocking control in assays to test for specificity of this AGBL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGBL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AGBL5

Antigène: AGBL5 (ATP/GTP Binding Protein-Like 5 (AGBL5))

Autre désignation: AGBL5 (AGBL5 Produits)

Synonymes: anticorps zgc:91997, anticorps MGC83526, anticorps AGBL5, anticorps ccp5, anticorps 4930455N08, anticorps 9430057O19Rik, anticorps CCP5, anticorps ATP/GTP binding protein-like 5, anticorps ATP/GTP binding protein-like 5 L homeolog, anticorps ATP/GTP binding protein like 5, anticorps cytosolic carboxypeptidase-like protein 5, anticorps agbl5, anticorps agbl5.L, anticorps AGBL5, anticorps LOC100181588, anticorps Agbl5

Sujet: AGBL5 belongs to the peptidase M14 family. The exact function of AGBL5 remains unknown.

Poids moléculaire: 47 kDa (MW of target protein)