CC2D1B anticorps (C-Term)

N° du produit ABIN630531

Cet anticorps anti-CC2D1B est un anticorps Lapin Polyclonal détectant CC2D1B dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CC2D1B anticorps (C-Term) (ABIN630531)

Antigène: CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CC2D1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CC2D1B anticorps

Épitope: C-Term

Specificité: CC2 D2 antibody was raised against the C terminal of CC2 2

Purification: Affinity purified

Immunogène: CC2 D2 antibody was raised using the C terminal of CC2 2 corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CC2D1B Blocking Peptide, (ABIN939593), is also available for use as a blocking control in assays to test for specificity of this CC2D1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CC0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CC2D1B

Antigène: CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))

Autre désignation: CC2D1B

Sujet: CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.

Poids moléculaire: 41 kDa (MW of target protein)