PAX8 anticorps (N-Term)

N° du produit ABIN630533

L’anticorps Lapin Polyclonal anti-PAX8 a été validé pour WB. Il convient pour détecter PAX8 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour PAX8 anticorps (N-Term) (ABIN630533)

Antigène: PAX8 (Paired Box 8 (PAX8))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAX8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PAX8 anticorps

Épitope: N-Term

Specificité: PAX8 antibody was raised against the N terminal of PAX8

Purification: Affinity purified

Immunogène: PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAX8 Blocking Peptide, (ABIN940042), is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAX8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAX8

Antigène: PAX8 (Paired Box 8 (PAX8))

Autre désignation: PAX8

Sujet: PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Regulation of Hormone Metabolic Process, Stem Cell Maintenance, Tube Formation