PAX8 anticorps (N-Term)
-
- Antigène Voir toutes PAX8 Anticorps
- PAX8 (Paired Box 8 (PAX8))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PAX8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PAX8 antibody was raised against the N terminal of PAX8
- Purification
- Affinity purified
- Immunogène
- PAX8 antibody was raised using the N terminal of PAX8 corresponding to a region with amino acids KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
- Top Product
- Discover our top product PAX8 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PAX8 Blocking Peptide, catalog no. 33R-4656, is also available for use as a blocking control in assays to test for specificity of this PAX8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAX8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PAX8 (Paired Box 8 (PAX8))
- Autre désignation
- PAX8 (PAX8 Produits)
- Synonymes
- anticorps PAX8, anticorps XPax-8, anticorps XPax8, anticorps pax-8, anticorps PAX-8, anticorps Pax-8, anticorps paired box 8, anticorps paired box 8 L homeolog, anticorps PAX8, anticorps pax8, anticorps Pax8, anticorps pax8.L
- Sujet
- PAX8 is a member of the paired box (PAX) family of transcription factors. Members of this family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in its gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas.
- Poids moléculaire
- 48 kDa (MW of target protein)
- Pathways
- Thyroid Hormone Synthesis, Regulation of Hormone Metabolic Process, Stem Cell Maintenance, Tube Formation
-