SH3BGR anticorps (N-Term)

N° du produit ABIN630536

L’anticorps anti-SH3BGR Polyclonal Lapin est utilisé pour la détection de SH3BGR dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SH3BGR anticorps (N-Term) (ABIN630536)

Antigène: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3BGR est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SH3BGR anticorps

Épitope: N-Term

Specificité: SH3 BGR antibody was raised against the N terminal of SH3 GR

Purification: Affinity purified

Immunogène: SH3 BGR antibody was raised using the N terminal of SH3 GR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3BGR Blocking Peptide, (ABIN937077), is also available for use as a blocking control in assays to test for specificity of this SH3BGR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3BGR

Antigène: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Autre désignation: SH3BGR

Sujet: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.

Poids moléculaire: 26 kDa (MW of target protein)