PRDM15 anticorps (Middle Region)

N° du produit ABIN630539

Détail du produit anti-PRDM15 anticorps

Antigène: PRDM15 (PR Domain Containing 15 (PRDM15))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRDM15 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRDM15 antibody was raised against the middle region of PRDM15

Purification: Affinity purified

Immunogène: PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRDM15 Blocking Peptide, catalog no. 33R-4819, is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDM15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRDM15

Antigène: PRDM15 (PR Domain Containing 15 (PRDM15))

Autre désignation: PRDM15 (PRDM15 Produits)

Synonymes: anticorps C21orf83, anticorps PFM15, anticorps ZNF298, anticorps E130018M06Rik, anticorps ORF62, anticorps Zfp298, anticorps PR domain containing 15, anticorps PR domain zinc finger protein 15, anticorps PR/SET domain 15, anticorps prdm15, anticorps LOC722504, anticorps PRDM15, anticorps Prdm15

Sujet: PRDM15 may be involved in transcriptional regulation.

Poids moléculaire: 134 kDa (MW of target protein)