PRDM15 anticorps (Middle Region)
-
- Antigène Voir toutes PRDM15 Anticorps
- PRDM15 (PR Domain Containing 15 (PRDM15))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRDM15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRDM15 antibody was raised against the middle region of PRDM15
- Purification
- Affinity purified
- Immunogène
- PRDM15 antibody was raised using the middle region of PRDM15 corresponding to a region with amino acids LCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPETTTIDASSIGIVQP
- Top Product
- Discover our top product PRDM15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRDM15 Blocking Peptide, catalog no. 33R-4819, is also available for use as a blocking control in assays to test for specificity of this PRDM15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDM15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRDM15 (PR Domain Containing 15 (PRDM15))
- Autre désignation
- PRDM15 (PRDM15 Produits)
- Synonymes
- anticorps C21orf83, anticorps PFM15, anticorps ZNF298, anticorps E130018M06Rik, anticorps ORF62, anticorps Zfp298, anticorps PR domain containing 15, anticorps PR domain zinc finger protein 15, anticorps PR/SET domain 15, anticorps prdm15, anticorps LOC722504, anticorps PRDM15, anticorps Prdm15
- Sujet
- PRDM15 may be involved in transcriptional regulation.
- Poids moléculaire
- 134 kDa (MW of target protein)
-