PWP2 anticorps

N° du produit ABIN630541

Cet anticorps Lapin Polyclonal détecte spécifiquement PWP2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour PWP2 anticorps (ABIN630541)

Antigène: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PWP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PWP2 anticorps

Purification: Affinity purified

Immunogène: PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PWP2 Blocking Peptide, (ABIN5615686), is also available for use as a blocking control in assays to test for specificity of this PWP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PWP2

Antigène: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Autre désignation: PWP2

Sujet: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Poids moléculaire: 102 kDa (MW of target protein)