PWP2 anticorps

N° du produit ABIN630541

Détail du produit anti-PWP2 anticorps

Antigène: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PWP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PWP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VQTGSIEGRHDLKTGRKELDKITAKHAAKGKAFTALCYSADGHSILAGGM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PWP2 Blocking Peptide, catalog no. 33R-9762, is also available for use as a blocking control in assays to test for specificity of this PWP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PWP2

Antigène: PWP2 (PWP2H) (PWP2 (Periodic Tryptophan Protein) Homolog (PWP2H))

Autre désignation: PWP2 (PWP2H Produits)

Synonymes: anticorps 6530411D08Rik, anticorps Pwp2h, anticorps wdp103, anticorps EHOC-17, anticorps PWP2H, anticorps UTP1, anticorps cb471, anticorps zgc:56063, anticorps PWP2 periodic tryptophan protein homolog (yeast), anticorps PWP2, small subunit processome component, anticorps Pwp2, anticorps PWP2, anticorps pwp2h

Sujet: PWP2 belongs to the WD repeat PWP2 family. It contains 14 WD repeats. The exact function of PWP2 is not known.

Poids moléculaire: 102 kDa (MW of target protein)