RRP1B anticorps

N° du produit ABIN630542

L’anticorps anti-RRP1B Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de RRP1B dans des échantillons provenant de Humain. }

Aperçu rapide pour RRP1B anticorps (ABIN630542)

Antigène: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRP1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RRP1B anticorps

Purification: Affinity purified

Immunogène: RRP1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRP1B Blocking Peptide, (ABIN5615964), is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RRP1B

Antigène: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Autre désignation: RRP1B

Sujet: RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Poids moléculaire: 84 kDa (MW of target protein)