RRP1B anticorps

N° du produit ABIN630542

Détail du produit anti-RRP1B anticorps

Antigène: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RRP1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RRP1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLHGVLKTPTSSP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RRP1B Blocking Peptide, catalog no. 33R-9842, is also available for use as a blocking control in assays to test for specificity of this RRP1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RRP1B

Antigène: RRP1B (Ribosomal RNA Processing 1 Homolog B (RRP1B))

Autre désignation: RRP1B (RRP1B Produits)

Synonymes: anticorps 2600005C20Rik, anticorps D030064A17, anticorps Kiaa0179, anticorps mKIAA0179, anticorps KIAA0179, anticorps NNP1L, anticorps Nnp1, anticorps RRP1, anticorps RGD1305633, anticorps ribosomal RNA processing 1B, anticorps ribosomal RNA processing 1 homolog B (S. cerevisiae), anticorps ribosomal RNA processing 1B L homeolog, anticorps RRP1B, anticorps Rrp1b, anticorps rrp1b.L

Sujet: RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.

Poids moléculaire: 84 kDa (MW of target protein)