Achaete-scute complex protein T5 (AC) (N-Term) anticorps

N° du produit ABIN630551

Détail du produit

Antigène: Achaete-scute complex protein T5 (AC)

Épitope: N-Term

Reactivité: Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: AC antibody was raised against the N terminal Of Ac

Purification: Affinity purified

Immunogène: AC antibody was raised using the N terminal Of Ac corresponding to a region with amino acids FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AC Blocking Peptide, catalog no. 33R-3003, is also available for use as a blocking control in assays to test for specificity of this AC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Achaete-scute complex protein T5 (AC)

Abstract: AC Produits

Synonymes: anticorps AC, anticorps ACDase, anticorps ASAH, anticorps PHP, anticorps PHP32, anticorps SMAPME, anticorps N-acylsphingosine amidohydrolase 1, anticorps ASAH1

Sujet: The function of AC protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 23 kDa (MW of target protein)