CKM anticorps (N-Term)

N° du produit ABIN630557

L’anticorps Lapin Polyclonal anti-CKM a été validé pour WB. Il convient pour détecter CKM dans des échantillons de Humain, Souris, Rat et Chien. Il y a 1 publication disponible.

Aperçu rapide pour CKM anticorps (N-Term) (ABIN630557)

Antigène: CKM (Creatine Kinase, Muscle (CKM))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CKM est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CKM anticorps

Épitope: N-Term

Specificité: CKMM antibody was raised against the N terminal of CKM

Purification: Affinity purified

Immunogène: CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CKMM Blocking Peptide, (ABIN5612903), is also available for use as a blocking control in assays to test for specificity of this CKMM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-CKM (ABIN630557)

Mihm, Yu, Reiser, Bauer: "Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." dans: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).

Détails sur CKM

Antigène: CKM (Creatine Kinase, Muscle (CKM))

Autre désignation: CKMM

Sujet: CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart.

Poids moléculaire: 43 kDa (MW of target protein)