CKM anticorps (N-Term)
-
- Antigène Voir toutes CKM Anticorps
- CKM (Creatine Kinase, Muscle (CKM))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CKM est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CKMM antibody was raised against the N terminal of CKM
- Purification
- Affinity purified
- Immunogène
- CKMM antibody was raised using the N terminal of CKM corresponding to a region with amino acids VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
- Top Product
- Discover our top product CKM Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CKMM Blocking Peptide, catalog no. 33R-9549, is also available for use as a blocking control in assays to test for specificity of this CKMM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." dans: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
: "
-
Effects of peroxynitrite on isolated cardiac trabeculae: selective impact on myofibrillar energetic controllers." dans: Biochimie, Vol. 85, Issue 6, pp. 587-96, (2003) (PubMed).
-
- Antigène
- CKM (Creatine Kinase, Muscle (CKM))
- Autre désignation
- CKMM (CKM Produits)
- Synonymes
- anticorps CKMM, anticorps M-CK, anticorps Ckmm, anticorps MCK, anticorps ckmm, anticorps m-ck, anticorps CKM, anticorps CK-M, anticorps cb51, anticorps ckm, anticorps mck, anticorps wu:fa28d05, anticorps ckm3, anticorps wu:fb55e09, anticorps zgc:64204, anticorps zgc:92070, anticorps creatine kinase, M-type, anticorps creatine kinase, muscle, anticorps creatine kinase, M-type L homeolog, anticorps creatine kinase, muscle a, anticorps creatine kinase, muscle b, anticorps CKM, anticorps Ckm, anticorps ckm.L, anticorps ckm, anticorps ckma, anticorps ckmb
- Sujet
- CKM is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart.
- Poids moléculaire
- 43 kDa (MW of target protein)
-