IFRD1 anticorps (N-Term)

N° du produit ABIN630559

Cet anticorps Lapin Polyclonal détecte spécifiquement IFRD1 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour IFRD1 anticorps (N-Term) (ABIN630559)

Antigène: IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFRD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IFRD1 anticorps

Épitope: N-Term

Specificité: IFRD1 antibody was raised against the N terminal of IFRD1

Purification: Affinity purified

Immunogène: IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFRD1 Blocking Peptide, (ABIN5614149), is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFRD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFRD1

Antigène: IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))

Autre désignation: IFRD1

Sujet: IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

Poids moléculaire: 50 kDa (MW of target protein)