PLSCR3 anticorps (Middle Region)

N° du produit ABIN630563

Détail du produit anti-PLSCR3 anticorps

Antigène: PLSCR3 (phospholipid Scramblase 3 (PLSCR3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLSCR3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PLSCR3 antibody was raised against the middle region of PLSCR3

Purification: Affinity purified

Immunogène: PLSCR3 antibody was raised using the middle region of PLSCR3 corresponding to a region with amino acids GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLSCR3 Blocking Peptide, catalog no. 33R-3187, is also available for use as a blocking control in assays to test for specificity of this PLSCR3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLSCR3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLSCR3

Antigène: PLSCR3 (phospholipid Scramblase 3 (PLSCR3))

Autre désignation: PLSCR3 (PLSCR3 Produits)

Sujet: PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Poids moléculaire: 32 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis