TSPY-Like 6 anticorps (N-Term)

N° du produit ABIN630567

Cet anticorps anti-TSPY-Like 6 est un anticorps Lapin Polyclonal détectant TSPY-Like 6 dans WB. Adapté pour Humain.

Aperçu rapide pour TSPY-Like 6 anticorps (N-Term) (ABIN630567)

Antigène: TSPY-Like 6 (TSPYL6)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TSPY-Like 6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TSPY-Like 6 anticorps

Épitope: N-Term

Specificité: TSPYL6 antibody was raised against the N terminal of TSPYL6

Purification: Affinity purified

Immunogène: TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TSPYL6 Blocking Peptide, (ABIN5616829), is also available for use as a blocking control in assays to test for specificity of this TSPYL6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TSPY-Like 6

Antigène: TSPY-Like 6 (TSPYL6)

Autre désignation: TSPYL6

Sujet: The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 46 kDa (MW of target protein)